S'mores Muffins Recipe - Gooey, Toasted & Easy
30-MINUTE MEALS! Get the email series now
Royal Recipe

S'mores Muffins

5 from 1 vote
1 Comments
Hannah Elizabeth
By: Hannah ElizabethUpdated: Sep 6, 2026
This post may contain affiliate links. Please read our disclosure policy.

Soft, tender muffins that capture the iconic s'mores trio—crushed graham, gooey marshmallows and melty chocolate—in every bite. Perfect for breakfast or dessert.

S'mores Muffins

These S'mores Muffins are the kind of recipe I reach for when I want a nostalgic treat that feels both playful and comforting. I first developed this version after a weekend camping trip when I couldn't stop thinking about the gooeyness of toasted marshmallows and the crunch of graham crackers. Recreating that combination in muffin form gave us the convenience of handheld s'mores without the campfire; the tops get slightly caramelized and the centers stay soft and studded with pockets of melted milk chocolate and marshmallow.

I discovered the balance of texture and sweetness by testing the batter with different proportions of crushed graham and brown sugar until it hit that line between cake and cookie. The result is a tender crumb with a hint of graham-cookie earthiness, a vanilla-scented batter, and the surprise of warm, melted chocolate and marshmallow when you bite in. These are especially memorable when served warm—my family gathers in the kitchen like we're at a picnic, forks forgotten, hands reaching for more.

Why You'll Love This Recipe

  • Recreates the classic campfire trio — graham, marshmallow and chocolate — in an easy-to-make, oven-baked format that’s ready in about 30 minutes total.
  • Uses pantry-friendly ingredients and standard equipment so you can pull these together on short notice for breakfast, snack time, or dessert.
  • Make-ahead friendly: the batter can be portioned into liners and baked fresh, or muffins can be frozen and reheated for quick treats.
  • Crowd-pleasing: the familiar flavors appeal to kids and adults alike, making them a reliable option for school bake sales or casual gatherings.
  • Flexible mix-ins: easy to adapt with dark chocolate, peanut butter chips, or larger marshmallows for an extra gooey top.

Personally, these muffins have become my go-to when I want to impress with minimal fuss. The first batch earned a standing ovation from my kids, and neighbors have asked for the recipe after catching a whiff through the door. Baking them warm and topping with a few extra mini marshmallows always feels like a small celebration at home.

Ingredients

  • All-purpose flour (1 3/4 cups / 220 g): Use unbleached flour for a slightly more pronounced wheat flavor and consistently tender crumb. Spoon and level the cup to avoid packing — this maintains the delicate texture.
  • Crushed graham crackers (1.5 ounces / about 3 sheets): I recommend using plain honey graham crackers; pulse in a food processor until fine but not powdery so you retain a subtle crunch and authentic s'mores flavor.
  • Light brown sugar (1/4 cup): Adds moisture and a toffee-like depth. If you only have dark brown sugar, the muffins will be slightly richer but still excellent.
  • Granulated sugar (1/4 cup): Balances sweetness and helps the tops caramelize when baked at a high initial heat.
  • Baking powder (2 teaspoons) and baking soda (1/2 teaspoon): A combination that gives lift and tender texture — the soda reacts with buttermilk for extra rise.
  • Salt (1/4 teaspoon) and pinch of freshly ground nutmeg: Salt enhances the chocolate and graham, while nutmeg adds a warm background note without being spicy.
  • Buttermilk (3/4 cup): Contributes tang and acidity to react with baking soda, producing a light crumb. If you don't have buttermilk, milk plus 1 tablespoon lemon juice works in a pinch.
  • Vegetable oil (1/2 cup): Keeps the muffins moist longer than butter; neutral flavor lets the chocolate and graham shine.
  • Large eggs (2): Provide structure and richness. Room temperature eggs incorporate more evenly into the batter.
  • Vanilla extract (1 teaspoon): Amplifies overall flavor and rounds the sweetness.
  • Milk chocolate chips (5 ounces / 142 g): Use good-quality chips for real melting pockets of chocolate. Reserve a few for topping.
  • Miniature marshmallows (2 ounces / 57 g): They melt into soft, gooey beads inside the muffins; extra on top will toast slightly in the oven for that campfire effect.

Instructions

Preheat and Prepare: Preheat the oven to 425F (220C). Line 8 large or 12 standard muffin cups with paper liners or lightly grease the tin. Starting at a high heat produces an initial burst of rise; reducing the temperature mid-bake prevents over-browning while finishing the interior. Combine Dry Ingredients: In a large bowl, whisk the flour, crushed graham crackers, brown sugar, granulated sugar, baking powder, baking soda, salt, and nutmeg until evenly distributed. Whisking ensures leavening agents and fine crumbs are dispersed to avoid pockets of baking powder. Mix Wet Ingredients: Make a well in the center of the dry mix and add the buttermilk, vegetable oil, eggs, and vanilla. Whisk gently just until combined—overmixing develops gluten and yields a dense muffin. A few small streaks of flour are fine. Fold in Mix-ins: Using a flexible spatula, fold the milk chocolate chips and mini marshmallows into the batter until evenly distributed. Fold slowly to avoid smashing the marshmallows; you want intact pockets that will melt during baking. Portion and Top: Divide the batter among prepared cups, filling each about 3/4 full. For a picture-perfect finish, press a few extra chips and marshmallows on top of each muffin; they’ll brown slightly and create an inviting look. Bake in Two Stages: Bake at 425F for 5 minutes to set the exterior and encourage rise, then reduce oven temperature to 350F (180C) and continue baking 10 to 15 minutes: regular muffins usually take 10 minutes, large up to 12 minutes. A toothpick should come out clean aside from melted chocolate—avoid testing near marshmallow pockets. Cool and Serve: Let the muffins cool in the pan 5 minutes to stabilize, then transfer to a wire rack. They are best enjoyed warm within a couple of hours when marshmallows are still soft. User provided content image 1

You Must Know

  • These turn out best the day theyre baked; the marshmallow pockets are especially delightful warm but will firm up after refrigeration.
  • Freeze fully cooled muffins in a single layer on a baking sheet, then transfer to a sealed bag for up to 3 months; reheat in a 350F oven for 8-10 minutes from frozen.
  • Because of the oil and sugar, the crumb stays tender for a day; refrigeration will extend life but can dry them, so reheat gently.
  • High initial heat improves oven spring—dont skip the 5-minute blast at 425F.

My favorite part is watching the marshmallows bubble through the batter as the chocolate melts—each muffin is a tiny surprise. Once, I brought a batch to a neighborhood picnic and everyone asked for the recipe; the kids were ecstatic and the adults admitted they loved feeling like a kid again with each toasted bite.

User provided content image 2

Storage Tips

Store cooled muffins at room temperature in an airtight container for up to two days to preserve the tender crumb and marshmallow softness. For longer storage, wrap each muffin individually in plastic wrap and place in a freezer-safe bag; this prevents freezer burn and keeps the marshmallow texture intact. To reheat, thaw in the refrigerator or at room temperature, then warm in a 325F oven for 6-8 minutes or microwave for 20-30 seconds for an immediate gooey result. Avoid refrigeration for more than a day unless you plan to reheat, as cold storage can make them slightly dry.

Ingredient Substitutions

If you dont have buttermilk, make a quick substitute by adding 1 tablespoon lemon juice or white vinegar to a measuring cup and filling to 3/4 cup with regular milk; let sit 5 minutes. Swap vegetable oil for melted unsalted butter for a richer flavor (use the same volume). Use dark chocolate chips or chopped chocolate for a deeper, less sweet profile—reduce granulated sugar by a tablespoon if you go very dark. For a gluten-free option, substitute a 1-to-1 gluten-free flour blend and ensure graham-style crumbs are from gluten-free crackers.

Serving Suggestions

Serve warm with a light dusting of powdered sugar or a drizzle of sweetened condensed milk for extra indulgence. Pair muffins with cold milk or a lightly brewed coffee to balance sweetness. For brunch, present them with fresh berries and Greek yogurt to cut through richness. Garnish with a few toasted marshmallows or a sprinkle of crushed graham for texture. These also travel well as an after-school snack tucked into lunchboxes—just pack a small napkin for sticky fingers.

Cultural Background

The s'mores combination is a distinctly North American tradition tied to campfires and summer gatherings. Turning this trio into baked goods has become common in home baking as a way to evoke nostalgia year-round without an actual fire. Muffins borrow from American quick-bread techniques—using chemical leaveners like baking powder and baking soda for lift—while integrating cookie-like elements such as crushed graham crumbs. This hybrid approach blends pastry and snack traditions in a way that appeals across generations.

Seasonal Adaptations

In cooler months, add a pinch of cinnamon and substitute milk chocolate with bittersweet for richer notes. Summer calls for lighter accompaniments like sliced peaches or a citrus yogurt. For holiday variations, fold in a tablespoon of peppermint extract and use dark chocolate chips for a festive twist, or mix in chopped toasted nuts for autumn gatherings. The basic method is forgiving—adjust mix-ins to reflect seasonal produce and flavor trends.

Success Stories

Readers often tell me these are the easiest way to get that campfire feeling indoors. One friend used the batter to make mini cupcakes for a school fundraiser and sold out within an hour. Another reader shared that swapping in white chocolate and crushed strawberries made a delightful birthday treat. These stories remind me that simple flavor combinations can become deeply personal when shared at breakfasts, bake sales, and backyard parties.

Meal Prep Tips

For make-ahead convenience, portion batter into muffin liners, cover the tray tightly with plastic wrap, and refrigerate for up to 24 hours before baking; you may need an extra minute or two in the oven. Alternatively, bake in advance and freeze cooled muffins; reheat as needed. If youre baking for a crowd, use jumbo tins and increase baking time to 15-18 minutes after the 5-minute high-heat start, checking for doneness with a toothpick away from marshmallow pockets.

These S'mores Muffins are a joyful reminder that the best treats are built from familiar flavors with thoughtful technique. Make a batch, share them warm, and let the simple pleasure of melted chocolate and marshmallow bring a smile to your table.

Pro Tips

  • Fill muffin cups only 3/4 full to allow for even rise and to avoid overflow.

  • Fold in marshmallows gently to keep pockets intact and avoid marshmallow clumping into one mass.

  • Start baking at 425F for 5 minutes then reduce to 350F to combine strong oven spring with even interior baking.

This nourishing s'mores muffins recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Can I substitute buttermilk?

Yes—if you dont have buttermilk, add 1 tablespoon lemon juice or white vinegar to milk to make a substitute. Allow it to sit 5 minutes before using.

How do I freeze and reheat these?

Freeze cooled muffins in a single layer on a sheet, then transfer to a sealed bag for up to 3 months. Reheat from frozen in a 350F oven for 8-10 minutes.

When are these best eaten?

They are best served warm within a couple of hours of baking. Refrigeration can dry them out; reheat gently to restore softness.

Tags

Sweet Endingsdessertbreakfastsnackcampingfamily-friendlyeasy recipe
No ratings yet

S'mores Muffins

This S'mores Muffins recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 12 steaks
S'mores Muffins
Prep:15 minutes
Cook:18 minutes
Rest Time:10 mins
Total:33 minutes

Ingredients

Main

Instructions

1

Preheat and line

Preheat oven to 425F (220C). Line 8 large or 12 standard muffin cups with liners or lightly grease the tin.

2

Whisk dry ingredients

In a large bowl, whisk together flour, crushed graham crackers, brown sugar, granulated sugar, baking powder, baking soda, salt, and nutmeg until evenly combined.

3

Add wet ingredients

Make a well in the center and add the buttermilk, vegetable oil, eggs, and vanilla. Whisk gently until just combined to avoid overworking the batter.

4

Fold in chips and marshmallows

Gently fold in milk chocolate chips and miniature marshmallows with a spatula, keeping marshmallows intact to create pockets of gooeyness.

5

Portion into tins

Transfer batter into prepared cups until 3/4 full. Top each with extra chips and marshmallows if desired for a toasted appearance.

6

Two-stage bake

Bake at 425F for 5 minutes, then reduce heat to 350F (180C) and bake another 10-15 minutes until a toothpick inserted comes out clean aside from melted chocolate.

7

Cool and rest

Cool in the pan 5 minutes, then remove to a wire rack. Serve warm for best texture and flavor.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 295kcal | Carbohydrates: 36g | Protein:
4g | Fat: 14g | Saturated Fat: 4g |
Polyunsaturated Fat: 3g | Monounsaturated Fat:
6g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@yumelle on social media!

S'mores Muffins

Categories:

S'mores Muffins

Did You Make This?

Leave a comment & rating below or tag @yumelle on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Hannah!

Chef and recipe creator specializing in delicious Sweet Endings cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.