Basic Risotto with Parmesan - Easy Recipe
30-MINUTE MEALS! Get the email series now
Royal Recipe

Basic Risotto with Parmesan

5 from 1 vote
1 Comments
Hannah Elizabeth
By: Hannah ElizabethUpdated: Jul 16, 2026
This post may contain affiliate links. Please read our disclosure policy.

A creamy, comforting Arborio rice dish finished with freshly grated Parmesan. Simple technique results in an elegant side or light main.

Basic Risotto with Parmesan

This risotto with Parmesan has a special place in my kitchen because it is both forgiving and rewarding. I first learned this approach on a rainy afternoon when I had pantry staples and wanted something that felt indulgent without fuss. The texture is what keeps me coming back creamy yet toothsome with each grain retaining a little bite. The aroma of warm stock and sautéed onion brings everyone to the table and makes a simple weeknight feel like a small celebration.

I discovered small adjustments that made a big difference. Using a light hand with the oil and stirring patiently yields rice that is glossy rather than gluey. Finishing with freshly grated Parmesan folded in off the heat gives the dish a silky finish and bright savory lift. This version is flexible so you can swap stock or cheese to suit preferences and dietary needs. Serve it beside roasted chicken or mushrooms to make it a full plate or enjoy it as a humble main with a crisp salad.

Why You'll Love This Recipe

  • Reliable technique that brings creamy results every time without complicated equipment or fuss.
  • Uses pantry friendly ingredients like Arborio rice and stock so it is perfect for last minute meals.
  • Ready in about 40 minutes from start to finish which fits well into a weeknight dinner routine.
  • Flexible: use vegetable stock and vegetarian or vegan Parmesan to adapt to dietary needs easily.
  • Finishes beautifully under a broiled protein or with roasted vegetables for a satisfying dinner.

In my house guests always ask for the method rather than the recipe because the stirring rhythm and small additions of stock are what make this memorable. My sibling who claims to dislike rice asks for seconds when I pair this with lemon roasted broccoli. The combination of creamy texture and nutty cheese creates comfort without being heavy.

Ingredients

  • Onion: 1 small onion, yellow white or red, peeled and finely chopped. Choose a firm onion with no soft spots. The onion sweats into the oil and forms the aromatic base for flavor rather than dominating the dish. A sweet yellow onion works well.
  • Olive oil: 2 tablespoons. Use a good quality extra virgin olive oil for aroma. It helps soften the onion and lends subtle fruitiness. Avoid overheating the oil to prevent bitterness.
  • Chicken stock: 4 cups. Home made or a low sodium store bought stock is best because you can control salt. For a vegetarian version use vegetable stock of comparable richness.
  • Water: 2 cups. Combined with the stock it provides the simmering liquid. Keeping some plain water makes the final texture less salty when using a salted stock.
  • White wine: 1 cup. Dry white wine adds acidity and depth. If you prefer not to use wine add 1 cup more stock or water. The alcohol cooks off leaving a bright fruit note.
  • Arborio rice: 2 cups. This short grain rice releases starch gradually which gives the classic creamy mouthfeel while still holding a slight bite at the center.
  • Parmesan cheese: 1 half cup freshly grated Parmesan. Freshly grated cheese melts and emulsifies better than pre grated. Substitute a vegetarian or plant based Parmesan if desired.
  • Black pepper: one eighth teaspoon freshly ground. Adds a gentle spice lift at the end.
  • Salt: to taste if needed. Many stocks are already salted so taste at the end before adding any extra salt.
User provided content image 2

Instructions

Prepare the aromatics:Peel and finely chop the onion so the pieces are uniform which helps them cook evenly. Place a deep 12 inch skillet over medium high heat and add the olive oil. When the oil shimmers add the onion and cook until tender and translucent about five minutes. Watch for any browning which will deepen flavor but can make the base taste sharp.Warm the liquids:While the onion cooks combine the chicken stock and water in a medium saucepan and set it over medium heat. Keep the stock at a gentle simmer so each ladle of liquid added to the rice is hot which keeps the cooking even and avoids shock cooling the rice.Toast and deglaze the rice:Add the Arborio rice to the skillet with the softened onion and stir to coat the grains in oil for one to two minutes. Toasting briefly helps the outer surface firm up and improves texture. Pour in the cup of white wine and stir, pushing the rice toward the center and scooping the wine over the grains until the liquid is mostly absorbed.Add stock gradually:Once the wine is absorbed add one ladle roughly half cup of the hot stock mixture. Stir frequently after each addition and wait until the liquid is mostly absorbed before adding the next ladle. The stirring helps release starch and creates the creamy texture. Adjust the heat under the stock so it stays at a gentle simmer. Continue this process about 30 to 35 minutes from the time the rice was added until the grains are tender but with a slight bite at the center.Finish and season:When the rice is just tender and the stock is nearly gone turn off the heat and stir in the grated Parmesan and the black pepper. The residual heat melts the cheese and forms a glossy emulsion. Taste for salt and adjust only if needed because the stock may already be seasoned.Serve and store:Spoon the risotto onto plates as a side dish or use it as a bed for roasted meat fish or vegetables. Any leftovers store in an airtight container in the refrigerator for up to four days and they also freeze well although the texture changes slightly on thawing.User provided content image 1

You Must Know

  • Keep the stock hot while cooking so the rice temperature remains steady and cooks evenly.
  • Stirring often but not constantly is enough to emulsify the starch without overworking the grains.
  • Finish off heat when adding the cheese to avoid grainy texture from overheating the dairy.
  • This is gluten free by nature if you select a gluten free stock and do not add any gluten containing toppings.

My favorite part is the simple rhythm of adding a ladle and stirring it in. It becomes almost meditative when you have a pot of simmering stock beside you. Family and friends comment on the silkiness each time I make it and it has earned a regular place at both casual dinners and small celebrations because it pairs well with so many proteins and vegetables.

Storage Tips

Cool leftovers quickly and transfer to airtight containers. Refrigerate within two hours of cooking and use within four days. For freezing portion into shallow freezer safe containers leaving head space. Label with the date and freeze for up to three months. When reheating thaw overnight in the refrigerator then warm gently on the stove with a splash of stock or water to loosen the texture. Reheat over low heat stirring to restore creaminess. Avoid high heat which can separate the emulsion and make the rice dry.

Ingredient Substitutions

If you prefer no alcohol replace the white wine with an equal amount of hot stock or water and a teaspoon of lemon juice for brightness. Use vegetable stock to make the dish vegetarian. Swap Parmesan for a vegetarian or vegan alternative to remove dairy if required. To add more depth try a small knob of butter folded in off the heat for an extra glossy finish. If Arborio is not available use Carnaroli or Vialone Nano which are also short grain rice varieties suited to this method.

Serving Suggestions

Risotto shines as a side under roasted chicken pan seared fish or braised short ribs. For a vegetarian meal serve it alongside roasted mushrooms or grilled asparagus. Garnish with extra grated Parmesan a drizzle of good olive oil and a scattering of chopped fresh herbs such as flat leaf parsley or chives. Serve in warm shallow bowls so the risotto stays creamy while you eat. Pair with a crisp salad and the same white wine used in the dish.

Cultural Background

Risotto is a classic technique from northern Italy where short grain rice has been cultivated for centuries. Each region offers variations for example saffron infused risotto alla Milanese from Milan or seafood versions along coastal areas. The hallmark is the method of gradual liquid addition and steady stirring which coax starch from the grains to make a rich texture without using heavy creams. The simplicity of the technique highlights quality ingredients and seasonal produce.

Seasonal Adaptations

Change the dish with the seasons by stirring in early spring peas and mint or late summer roasted cherry tomatoes and basil. In autumn fold in sautéed wild mushrooms and finish with a splash of truffle oil for a special occasion. Winter is ideal for adding roasted root vegetables or wilted greens and a squeeze of lemon brightens the richer flavors. Small ingredient swaps keep the technique the same while refreshing the flavor profile.

Meal Prep Tips

For make ahead meals cook the risotto until just shy of done a few minutes before the grains are tender. Cool quickly and chill. When ready to serve warm gently with a few tablespoons of hot stock stirring until the rice finishes cooking. Portion into meal prep containers and include a small container of grated Parmesan on the side to be added after reheating. This preserves the fresh cheese aroma and gives each portion a finishing touch when served.

Making this risotto creates an approachable elegant dish you can adapt to many menus. The method becomes intuitive the more you practice and the rewards are a consistently creamy satisfying result that warms the table and invites conversation.

Pro Tips

  • Keep the cooking liquid hot so rice temperature stays consistent which prevents gummy texture.

  • Toast the rice briefly in oil to firm the outer surface and improve texture.

  • Finish the dish off heat when adding cheese to prevent the dairy from separating.

This nourishing basic risotto with parmesan recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Cozy Comfort reciperisottoparmesanitaliandinnerrice-dishesweeknight-friendly
No ratings yet

Basic Risotto with Parmesan

This Basic Risotto with Parmesan recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Basic Risotto with Parmesan
Prep:10 minutes
Cook:35 minutes
Rest Time:10 mins
Total:45 minutes

Ingredients

Main

Instructions

1

Prepare aromatics and oil

Peel and finely chop the onion into even small pieces. Heat a deep 12 inch skillet over medium high heat and add the olive oil. When the oil shimmers add the onion and cook until translucent and tender about five minutes watching to prevent browning.

2

Warm the stock

Combine the chicken stock and water in a medium saucepan and set over medium heat to maintain a gentle simmer. Keep a ladle handy to transfer hot liquid to the rice which ensures even cooking.

3

Toast the rice and deglaze

Add the Arborio rice to the skillet with the softened onion and stir for one to two minutes until the grains are glossy. Pour in the cup of white wine and stir, pushing rice to the center and scooping the wine until it is absorbed.

4

Add stock gradually

Add a ladle about half cup of the hot stock to the rice and stir frequently until absorbed. Repeat adding one ladle at a time stirring in between. Continue this for 30 to 35 minutes until the rice is tender with a slight bite and the mixture is creamy.

5

Finish with cheese and seasoning

Turn off the heat and stir in the freshly grated Parmesan and the black pepper until glossy. Taste and add salt only if needed then serve immediately as a side or beneath your chosen proteins or vegetables.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 520kcal | Carbohydrates: 90g | Protein:
14g | Fat: 12g | Saturated Fat: 4g |
Polyunsaturated Fat: 2g | Monounsaturated Fat:
5g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@yumelle on social media!

Basic Risotto with Parmesan

Categories:

Basic Risotto with Parmesan

Did You Make This?

Leave a comment & rating below or tag @yumelle on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Hannah!

Chef and recipe creator specializing in delicious Cozy Comfort cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.